Lineage for d2vhng1 (2vhn G:1-81)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217079Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 2217080Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 2217081Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 2217082Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 2217099Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
    Uniprot P02390 1-81! Uniprot P02390 82-176
  8. 2217142Domain d2vhng1: 2vhn G:1-81 [153099]
    Other proteins in same PDB: d2vhn01, d2vhn11, d2vhn31, d2vhn41, d2vhnc1, d2vhnc2, d2vhnd1, d2vhne1, d2vhnf1, d2vhnh1, d2vhnh2, d2vhni1, d2vhni2, d2vhnj1, d2vhnk1, d2vhnl1, d2vhnm1, d2vhnn1, d2vhno1, d2vhnp1, d2vhnq1, d2vhnr1, d2vhns1, d2vhnt1, d2vhnu1, d2vhnv1, d2vhnw1, d2vhnx1, d2vhny1, d2vhnz1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2vhng1

PDB Entry: 2vhn (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome. (Structure 2 of 4)
PDB Compounds: (G:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2vhng1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhng1 d.141.1.1 (G:1-81) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
srvakapvvvpagvdvkingqvitikgkngeltrtlndavevkhadntltfgprdgyadg
waqagtarallnsmvigvteg

SCOPe Domain Coordinates for d2vhng1:

Click to download the PDB-style file with coordinates for d2vhng1.
(The format of our PDB-style files is described here.)

Timeline for d2vhng1: