Lineage for d2vhmz1 (2vhm Z:1-70)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1053512Fold d.325: L28p-like [143799] (1 superfamily)
    unusual fold consisting of three beta-hairpins, that form a paper clip-like structure, and two helices; could have evolved from a glucocorticoid receptor-like zinc finger domain (57715)
  4. 1053513Superfamily d.325.1: L28p-like [143800] (2 families) (S)
    In early ribosomal structures, L28p has been misinterpreted as L31p. in the Ribosomal protein L28p family, there are sequences containing two CxxC pairs. Threading these sequences into this fold brings the four cysteines in a similar site to the zinc-binding site of glucocorticoid receptor-like zinc fingers. In the Ribosomal protein L31p, there are also members with two CxxC pairs. However, these won't form a putative zinc-binding site in this fold. The L31p family are classified here temporarily, until its true fold is known
  5. 1053546Family d.325.1.2: Ribosomal protein L31p [143804] (1 protein)
    Pfam PF01197
  6. 1053547Protein Ribosomal protein L31p [143805] (2 species)
  7. 1053548Species Escherichia coli [TaxId:562] [143806] (9 PDB entries)
    Uniprot P0A7M9 1-70
  8. 1053553Domain d2vhmz1: 2vhm Z:1-70 [153089]
    Other proteins in same PDB: d2vhm01, d2vhm11, d2vhm31, d2vhm41, d2vhmc1, d2vhmc2, d2vhmd1, d2vhme1, d2vhmf1, d2vhmg1, d2vhmg2, d2vhmh1, d2vhmh2, d2vhmi1, d2vhmi2, d2vhmj1, d2vhmk1, d2vhml1, d2vhmm1, d2vhmn1, d2vhmo1, d2vhmp1, d2vhmq1, d2vhmr1, d2vhms1, d2vhmt1, d2vhmu1, d2vhmv1, d2vhmw1, d2vhmx1, d2vhmy1
    automatically matched to d1vs6z1
    protein/RNA complex; complexed with mg

Details for d2vhmz1

PDB Entry: 2vhm (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome
PDB Compounds: (Z:) 50S ribosomal protein L31

SCOPe Domain Sequences for d2vhmz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhmz1 d.325.1.2 (Z:1-70) Ribosomal protein L31p {Escherichia coli [TaxId: 562]}
mkkdihpkyeeitascscgnvmkirstvghdlnldvcskchpfftgkqrdvatggrvdrf
nkrfnipgsk

SCOPe Domain Coordinates for d2vhmz1:

Click to download the PDB-style file with coordinates for d2vhmz1.
(The format of our PDB-style files is described here.)

Timeline for d2vhmz1: