Class b: All beta proteins [48724] (176 folds) |
Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) |
Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins) |
Protein Ribosomal protein L25 [50717] (1 species) |
Species Escherichia coli [TaxId:562] [50718] (32 PDB entries) |
Domain d2vhmv1: 2vhm V:1-94 [153085] Other proteins in same PDB: d2vhm01, d2vhm11, d2vhm31, d2vhm41, d2vhmc1, d2vhmc2, d2vhmd1, d2vhme1, d2vhmf1, d2vhmg1, d2vhmg2, d2vhmh1, d2vhmh2, d2vhmi1, d2vhmi2, d2vhmj1, d2vhmk1, d2vhml1, d2vhmm1, d2vhmn1, d2vhmo1, d2vhmp1, d2vhmq1, d2vhmr1, d2vhms1, d2vhmt1, d2vhmu1, d2vhmw1, d2vhmx1, d2vhmy1, d2vhmz1 automatically matched to d1b75a_ protein/RNA complex; complexed with mg |
PDB Entry: 2vhm (more details), 3.74 Å
SCOPe Domain Sequences for d2vhmv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhmv1 b.53.1.1 (V:1-94) Ribosomal protein L25 {Escherichia coli [TaxId: 562]} mftinaevrkeqgkgasrrlraankfpaiiyggkeaplaieldhdkvmnmqakaefysev ltivvdgkeikvkaqdvqrhpykpklqhidfvra
Timeline for d2vhmv1:
View in 3D Domains from other chains: (mouse over for more information) d2vhm01, d2vhm11, d2vhm31, d2vhm41, d2vhmc1, d2vhmc2, d2vhmd1, d2vhme1, d2vhmf1, d2vhmg1, d2vhmg2, d2vhmh1, d2vhmh2, d2vhmi1, d2vhmi2, d2vhmj1, d2vhmk1, d2vhml1, d2vhmm1, d2vhmn1, d2vhmo1, d2vhmp1, d2vhmq1, d2vhmr1, d2vhms1, d2vhmt1, d2vhmu1, d2vhmw1, d2vhmx1, d2vhmy1, d2vhmz1 |