Class a: All alpha proteins [46456] (284 folds) |
Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) |
Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein) |
Protein Ribosomal protein L20 [74733] (4 species) |
Species Escherichia coli [TaxId:562] [158511] (29 PDB entries) Uniprot P0A7L3 1-117 |
Domain d2vhmq1: 2vhm Q:1-117 [153080] Other proteins in same PDB: d2vhm01, d2vhm11, d2vhm31, d2vhm41, d2vhmc1, d2vhmc2, d2vhmd1, d2vhme1, d2vhmf1, d2vhmg1, d2vhmg2, d2vhmh1, d2vhmh2, d2vhmi1, d2vhmi2, d2vhmj1, d2vhmk1, d2vhml1, d2vhmm1, d2vhmn1, d2vhmo1, d2vhmp1, d2vhmr1, d2vhms1, d2vhmt1, d2vhmu1, d2vhmv1, d2vhmw1, d2vhmx1, d2vhmy1, d2vhmz1 automatically matched to 2AW4 Q:1-117 complexed with mg; mutant |
PDB Entry: 2vhm (more details), 3.74 Å
SCOP Domain Sequences for d2vhmq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhmq1 a.144.2.1 (Q:1-117) Ribosomal protein L20 {Escherichia coli [TaxId: 562]} arvkrgviararhkkilkqakgyygarsrvyrvafqavikagqyayrdrrqrkrqfrqlw iarinaaarqngisyskfinglkkasveidrkiladiavfdkvaftalvekakaala
Timeline for d2vhmq1:
View in 3D Domains from other chains: (mouse over for more information) d2vhm01, d2vhm11, d2vhm31, d2vhm41, d2vhmc1, d2vhmc2, d2vhmd1, d2vhme1, d2vhmf1, d2vhmg1, d2vhmg2, d2vhmh1, d2vhmh2, d2vhmi1, d2vhmi2, d2vhmj1, d2vhmk1, d2vhml1, d2vhmm1, d2vhmn1, d2vhmo1, d2vhmp1, d2vhmr1, d2vhms1, d2vhmt1, d2vhmu1, d2vhmv1, d2vhmw1, d2vhmx1, d2vhmy1, d2vhmz1 |