SCOP 1.75: Domain d2vhmh2: 2vhm H:1-58

Lineage for d2vhmh2 (2vhm H:1-58)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.1: L9 N-domain-like [55658] (2 families)

5. Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)

6. Protein Ribosomal protein L9 N-domain [55660] (3 species)

7. Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
   Uniprot P0A7R1 1-58

8. Domain d2vhmh2: 2vhm H:1-58 [153070]
   Other proteins in same PDB: d2vhm01, d2vhm11, d2vhm31, d2vhm41, d2vhmc1, d2vhmc2, d2vhmd1, d2vhme1, d2vhmf1, d2vhmg1, d2vhmg2, d2vhmh1, d2vhmi1, d2vhmi2, d2vhmj1, d2vhmk1, d2vhml1, d2vhmm1, d2vhmn1, d2vhmo1, d2vhmp1, d2vhmq1, d2vhmr1, d2vhms1, d2vhmt1, d2vhmu1, d2vhmv1, d2vhmw1, d2vhmx1, d2vhmy1, d2vhmz1
   automatically matched to 2AW4 H:1-58
   complexed with mg; mutant

Details for d2vhmh2

PDB Entry: 2vhm, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome

PDB Compounds: (H:) 50S ribosomal protein L9

SCOP Domain Sequences for d2vhmh2:

Sequence; same for both SEQRES and ATOM records:

>d2vhmh2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

Timeline for d2vhmh2:

• d2vhmh2 is new in SCOP 1.75
  
• d2vhmh2 appears in SCOPe 2.01
  
• d2vhmh2 appears in the current release, SCOPe 2.08