![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.57: Transposase IS200-like [143422] (1 family) ![]() contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer automatically mapped to Pfam PF01797 |
![]() | Family d.58.57.1: Transposase IS200-like [143423] (4 proteins) Pfam PF01797 |
![]() | Protein ISHP608 transposase [143426] (1 species) |
![]() | Species Helicobacter pylori [TaxId:210] [143427] (7 PDB entries) Uniprot Q933Z0 4-133 |
![]() | Domain d2vhgb1: 2vhg B:6-131 [153057] automatically matched to d2a6ma1 protein/DNA complex; complexed with mn |
PDB Entry: 2vhg (more details), 2.9 Å
SCOPe Domain Sequences for d2vhgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhgb1 d.58.57.1 (B:6-131) ISHP608 transposase {Helicobacter pylori [TaxId: 210]} lyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqtdkdhi hiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggaplnvvk qyienq
Timeline for d2vhgb1: