SCOPe 2.08: Domain d2vheb_: 2vhe B:

Lineage for d2vheb_ (2vhe B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.8: PglD-like [159280] (2 proteins)
   contains extra N-terminal alpha/beta subdomain
   this is a repeat family; one repeat unit is 2npo A:101-119 found in domain

6. Protein Acetyltransferase PglD [159281] (1 species)

7. Species Campylobacter jejuni [TaxId:197] [159282] (6 PDB entries)
   Uniprot Q0P9D1 3-197

8. Domain d2vheb_: 2vhe B: [153055]
   automated match to d2npoa1
   complexed with coa, so4

Details for d2vheb_

PDB Entry: 2vhe, 1.8 Å

PDB Description: pgld-coa complex: an acetyl transferase from campylobacter jejuni

PDB Compounds: (B:) Acetyltransferase

SCOPe Domain Sequences for d2vheb_:

Sequence, based on SEQRES records:

>d2vheb_ b.81.1.8 (B:) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]}
artekiyiygasghglvcedvaknmgykeciflddfkgmkfestlpkydffiaignneir
kkiyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntss
viehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknq
dekgvfvgvpakrm

Sequence, based on observed residues (ATOM records):

>d2vheb_ b.81.1.8 (B:) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]}
artekiyiygasghglvcedvaknmgykecifldpkydffiaignneirkkiyqkiseng
fkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssviehecvigef
shvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqkgvfvgvpakr
m

Timeline for d2vheb_:

• d2vheb_ first appeared in SCOP 1.75, called d2vheb1
  
• d2vheb_ appears in SCOPe 2.07