Lineage for d2vhdb2 (2vhd B:165-323)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 761073Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
    duplication: contains two cytochrome c-type domains
  6. 761074Protein Di-heme cytochrome c peroxidase [46686] (3 species)
  7. 761084Species Pseudomonas aeruginosa [TaxId:287] [46687] (2 PDB entries)
  8. 761090Domain d2vhdb2: 2vhd B:165-323 [153053]
    automatically matched to d1eb7a2
    complexed with ca, hec

Details for d2vhdb2

PDB Entry: 2vhd (more details), 2.3 Å

PDB Description: crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa - mixed valence form
PDB Compounds: (B:) cytochrome c551 peroxidase

SCOP Domain Sequences for d2vhdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhdb2 a.3.1.5 (B:165-323) Di-heme cytochrome c peroxidase {Pseudomonas aeruginosa [TaxId: 287]}
tpdspfdlylkgddkaldaqqkkglkafmdsgcsachnginlggqayfpfglvkkpdasv
lpsgdkgrfavtktqsdeyvfraaplrnvaltapyfhsgqvwelkdavaimgnaqlgkql
apddvenivaflhslsgkqprveypllpastettprpae

SCOP Domain Coordinates for d2vhdb2:

Click to download the PDB-style file with coordinates for d2vhdb2.
(The format of our PDB-style files is described here.)

Timeline for d2vhdb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vhdb1