SCOP 1.75: Domain d2vhda2: 2vhd A:165-323

Lineage for d2vhda2 (2vhd A:165-323)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
   duplication: contains two cytochrome c-type domains

6. Protein Di-heme cytochrome c peroxidase [46686] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [46687] (2 PDB entries)

8. Domain d2vhda2: 2vhd A:165-323 [153051]
   automatically matched to d1eb7a2
   complexed with ca, hec

Details for d2vhda2

PDB Entry: 2vhd, 2.3 Å

PDB Description: crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa - mixed valence form

PDB Compounds: (A:) cytochrome c551 peroxidase

SCOP Domain Sequences for d2vhda2:

Sequence; same for both SEQRES and ATOM records:

>d2vhda2 a.3.1.5 (A:165-323) Di-heme cytochrome c peroxidase {Pseudomonas aeruginosa [TaxId: 287]}
tpdspfdlylkgddkaldaqqkkglkafmdsgcsachnginlggqayfpfglvkkpdasv
lpsgdkgrfavtktqsdeyvfraaplrnvaltapyfhsgqvwelkdavaimgnaqlgkql
apddvenivaflhslsgkqprveypllpastettprpae

Timeline for d2vhda2:

• d2vhda2 is new in SCOP 1.75
  
• d2vhda2 appears in SCOPe 2.01
  
• d2vhda2 appears in the current release, SCOPe 2.08