Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.3: L30e-like [55315] (3 families) |
Family d.79.3.2: ERF1/Dom34 C-terminal domain-like [55323] (3 proteins) automatically mapped to Pfam PF03465 |
Protein Dom34 [160509] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [160510] (2 PDB entries) Uniprot P33309 278-381 |
Domain d2vgnb3: 2vgn B:278-381 [153045] Other proteins in same PDB: d2vgna1, d2vgna2, d2vgnb1, d2vgnb2 automated match to d2vgma3 complexed with gol, po4 |
PDB Entry: 2vgn (more details), 2.5 Å
SCOPe Domain Sequences for d2vgnb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vgnb3 d.79.3.2 (B:278-381) Dom34 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} skeimvmdefllhlnkdddkawygekevvkaaeygaisyllltdkvlhsdniaqreeylk lmdsvesnggkalvlstlhslgeeldqltgiacilkyplpdlde
Timeline for d2vgnb3: