Lineage for d2vgnb2 (2vgn B:136-277)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 837367Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 837531Family c.55.4.2: ERF1/Dom34 middle domain-like [53143] (3 proteins)
  6. 837535Protein Dom34 [159645] (1 species)
  7. 837536Species Saccharomyces cerevisiae [TaxId:4932] [159646] (2 PDB entries)
    Uniprot P33309 136-277
  8. 837538Domain d2vgnb2: 2vgn B:136-277 [153044]
    Other proteins in same PDB: d2vgna1, d2vgna3, d2vgnb1, d2vgnb3
    automatically matched to 2VGM A:136-277
    complexed with gol, po4

Details for d2vgnb2

PDB Entry: 2vgn (more details), 2.5 Å

PDB Description: structure of yeast dom34 : a protein related to translation termination factor erf1 and involved in no-go decay.
PDB Compounds: (B:) dom34

SCOP Domain Sequences for d2vgnb2:

Sequence, based on SEQRES records: (download)

>d2vgnb2 c.55.4.2 (B:136-277) Dom34 {Saccharomyces cerevisiae [TaxId: 4932]}
ieyksdtaavvlqegiahvclvtssstilkqkieysmpkkkrttdvlkfdektekfykai
ysamkkdlnfdklktiilcspgfyakilmdkifqyaeeehnkkildnkgmffiahcstgy
lqginevlknplyasklqdtky

Sequence, based on observed residues (ATOM records): (download)

>d2vgnb2 c.55.4.2 (B:136-277) Dom34 {Saccharomyces cerevisiae [TaxId: 4932]}
ieyksdtaavvlqegiahvclvtssstilkqkieyvlkfdektekfykaiysamkkdlnf
dklktiilcspgfyakilmdkifqyaeeehnkkildnkgmffiahcstgylqginevlkn
plyasklqdtky

SCOP Domain Coordinates for d2vgnb2:

Click to download the PDB-style file with coordinates for d2vgnb2.
(The format of our PDB-style files is described here.)

Timeline for d2vgnb2: