Lineage for d2vgma3 (2vgm A:278-381)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865651Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 865875Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 865984Family d.79.3.2: ERF1/Dom34 C-terminal domain-like [55323] (3 proteins)
  6. 865993Protein Dom34 [160509] (1 species)
  7. 865994Species Saccharomyces cerevisiae [TaxId:4932] [160510] (2 PDB entries)
    Uniprot P33309 278-381
  8. 865997Domain d2vgma3: 2vgm A:278-381 [153039]
    Other proteins in same PDB: d2vgma1, d2vgma2

Details for d2vgma3

PDB Entry: 2vgm (more details), 2.6 Å

PDB Description: structure of yeast dom34 : a protein related to translation termination factor erf1 and involved in no-go decay.
PDB Compounds: (A:) dom34

SCOP Domain Sequences for d2vgma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vgma3 d.79.3.2 (A:278-381) Dom34 {Saccharomyces cerevisiae [TaxId: 4932]}
skeimvmdefllhlnkdddkawygekevvkaaeygaisyllltdkvlhsdniaqreeylk
lmdsvesnggkalvlstlhslgeeldqltgiacilkyplpdlde

SCOP Domain Coordinates for d2vgma3:

Click to download the PDB-style file with coordinates for d2vgma3.
(The format of our PDB-style files is described here.)

Timeline for d2vgma3: