Lineage for d2vgma1 (2vgm A:1-135)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798178Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 798546Superfamily b.38.4: Dom34/Pelota N-terminal domain-like [159065] (1 family) (S)
  5. 798547Family b.38.4.1: Dom34/Pelota N-terminal domain-like [159066] (2 proteins)
    Warning: Pfam incorrectly assigns this domain to the same family as the structurally unrelated N-terminal domain of eRF1 (Pfam PF03463)
  6. 798551Protein Dom34 [159069] (1 species)
  7. 798552Species Saccharomyces cerevisiae [TaxId:4932] [159070] (2 PDB entries)
    Uniprot P33309 1-135
  8. 798555Domain d2vgma1: 2vgm A:1-135 [153037]
    Other proteins in same PDB: d2vgma2, d2vgma3

Details for d2vgma1

PDB Entry: 2vgm (more details), 2.6 Å

PDB Description: structure of yeast dom34 : a protein related to translation termination factor erf1 and involved in no-go decay.
PDB Compounds: (A:) dom34

SCOP Domain Sequences for d2vgma1:

Sequence, based on SEQRES records: (download)

>d2vgma1 b.38.4.1 (A:1-135) Dom34 {Saccharomyces cerevisiae [TaxId: 4932]}
mkvislkkdsfnkggavitllpedkedlftvyqivdkddelifkkkftskldeagkkkst
dlvklkikvisedfdmkdeylkykgvtvtdesgasnvdipvgkylsftldyvypftiikq
nfnkfmqkllneacn

Sequence, based on observed residues (ATOM records): (download)

>d2vgma1 b.38.4.1 (A:1-135) Dom34 {Saccharomyces cerevisiae [TaxId: 4932]}
mkvislkggavitllpedkedlftvyqivdkddelifkkkftdlvklkikvisedfdmkd
eylkykgvtvtdesgasnvdipvgkylsftldyvypftiikqnfnkfmqkllneacn

SCOP Domain Coordinates for d2vgma1:

Click to download the PDB-style file with coordinates for d2vgma1.
(The format of our PDB-style files is described here.)

Timeline for d2vgma1: