Lineage for d2vg8a_ (2vg8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142483Family c.87.1.10: UDPGT-like [159785] (5 protein domains)
    Pfam PF00201
  6. 2142487Protein Hydroquinone glucosyltransferase [159792] (1 species)
  7. 2142488Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [159793] (4 PDB entries)
    Uniprot Q9M156 6-476
  8. 2142491Domain d2vg8a_: 2vg8 A: [153034]
    automated match to d2vcea1
    complexed with edo, trs, udp

Details for d2vg8a_

PDB Entry: 2vg8 (more details), 1.75 Å

PDB Description: characterization and engineering of the bifunctional n- and o-glucosyltransferase involved in xenobiotic metabolism in plants
PDB Compounds: (A:) hydroquinone glucosyltransferase

SCOPe Domain Sequences for d2vg8a_:

Sequence, based on SEQRES records: (download)

>d2vg8a_ c.87.1.10 (A:) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tphvaiipspgmghliplvefakrlvhlhgltvtfviagegppskaqrtvldslpssiss
vflppvdltdlssstriesrisltvtrsnpelrkvfdsfveggrlptalvvdlfgtdafd
vavefhvppyifypttanvlsfflhlpkldetvscefrelteplmlpgcvpvagkdfldp
aqdrkddaykwllhntkrykeaegilvntffelepnaikalqepgldkppvypvgplvni
gkqeakqteeseclkwldnqplgsvlyvsfgsggtltceqlnelalgladseqrflwvir
spsgianssyfdshsqtdpltflppgflertkkrgfvipfwapqaqvlahpstggflthc
gwnstlesvvsgipliawplyaeqkmnavllsediraalrpragddglvrreevarvvkg
lmegeegkgvrnkmkelkeaacrvlkddgtstkalslvalkwkahkkeleq

Sequence, based on observed residues (ATOM records): (download)

>d2vg8a_ c.87.1.10 (A:) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tphvaiipspgmghliplvefakrlvhlhgltvtfviagegppskaqrtvldslpssiss
vflppvdltdlssstriesrisltvtrsnpelrkvfdsfveggrlptalvvdlfgtdafd
vavefhvppyifypttanvlsfflhlpkldetvscefrelteplmlpgcvpvagkdfldp
aqdrkddaykwllhntkrykeaegilvntffelepnaikalqepgldkppvypvgplvni
gkqeeseclkwldnqplgsvlyvsfgsggtltceqlnelalgladseqrflwvirspsgi
anssyfdshsqtdpltflppgflertkkrgfvipfwapqaqvlahpstggflthcgwnst
lesvvsgipliawplyaeqkmnavllsediraalrpragddglvrreevarvvkglmege
egkgvrnkmkelkeaacrvlkddgtstkalslvalkwkahkkeleq

SCOPe Domain Coordinates for d2vg8a_:

Click to download the PDB-style file with coordinates for d2vg8a_.
(The format of our PDB-style files is described here.)

Timeline for d2vg8a_: