![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.2: Reverse transcriptase [56686] (3 proteins) |
![]() | Protein HIV-1 reverse transcriptase [56689] (4 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (204 PDB entries) Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595 |
![]() | Domain d2vg5b_: 2vg5 B: [153031] Other proteins in same PDB: d2vg5a1, d2vg5a2 automated match to d3hvtb_ protein/DNA complex; protein/RNA complex; complexed with nnc |
PDB Entry: 2vg5 (more details), 2.8 Å
SCOPe Domain Sequences for d2vg5b_:
Sequence, based on SEQRES records: (download)
>d2vg5b_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]} ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqym ddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpi vlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelela enreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtnd vkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvk lwyq
>d2vg5b_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]} ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik kkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedf rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqym ddlyvgsdleigqhrtkieelrqhllrwglmgyelhpdkwtvqpivlpekdswtvndiqk lvgklnwasqiypgikvrqlckltkalteviplteeaelelaenreilkepvhgvyydps kdliaeiqkqgqgqwtyqiyqepfknlktgkyahtndvkqlteavqkittesiviwgktp kfklpiqketwetwwteywqatwipewefvntpplvklwyq
Timeline for d2vg5b_: