Lineage for d2vera1 (2ver A:1-123)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040518Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2040841Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
    Pfam PF04619
  6. 2040842Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)
  7. 2040843Species Escherichia coli [TaxId:562] [110077] (11 PDB entries)
    Uniprot Q57254 P24093 23-159
  8. 2040887Domain d2vera1: 2ver A:1-123 [153026]
    Other proteins in same PDB: d2vera2
    automatically matched to d1rxla_
    complexed with mtn

Details for d2vera1

PDB Entry: 2ver (more details)

PDB Description: structural model for the complex between the dr adhesins and carcinoembryonic antigen (cea)
PDB Compounds: (A:) afimbrial adhesin afa-III

SCOPe Domain Sequences for d2vera1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vera1 b.2.3.6 (A:1-123) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
eecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalkadtdnfeqgkfflisdn
nrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgqqtntppgnytltltggy
wak

SCOPe Domain Coordinates for d2vera1:

Click to download the PDB-style file with coordinates for d2vera1.
(The format of our PDB-style files is described here.)

Timeline for d2vera1: