SCOPe 2.06: Domain d2vepa_: 2vep A:

Lineage for d2vepa_ (2vep A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
   structural evidence for the gene duplication within the barrel fold
   automatically mapped to Pfam PF00977

6. Protein automated matches [190186] (10 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:1902] [189237] (2 PDB entries)

8. Domain d2vepa_: 2vep A: [153025]
   automated match to d2x30a_
   complexed with so4

Details for d2vepa_

PDB Entry: 2vep, 1.8 Å

PDB Description: crystal structure of the full length bifunctional enzyme pria

PDB Compounds: (A:) phosphoribosyl isomerase a

SCOPe Domain Sequences for d2vepa_:

Sequence; same for both SEQRES and ATOM records:

>d2vepa_ c.1.2.1 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
msklellpavdvrdgqavrlvhgesgtetsygspleaalawqrsgaewlhlvdldaafgt
gdnraliaevaqamdikvelsggirdddtlaaalatgctrvnlgtaaletpewvakviae
hgdkiavgldvrgttlrgrgwtrdggdlyetldrlnkegcaryvvtdiakdgtlqgpnle
llknvcaatdrpvvasggvsslddlraiaglvpagvegaivgkalyakaftleealeats
l

Timeline for d2vepa_:

• d2vepa_ first appeared in SCOP 1.75, called d2vepa1
  
• d2vepa_ appears in SCOPe 2.05
  
• d2vepa_ appears in SCOPe 2.07
  
• d2vepa_ appears in the current release, SCOPe 2.08