| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.67: FtsK C-terminal domain-like [140295] (2 proteins) PfamB PB000224 automatically mapped to Pfam PF09397 |
| Protein automated matches [190361] (1 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:287] [187192] (2 PDB entries) |
| Domain d2ve9a_: 2ve9 A: [153016] automated match to d2j5oa1 complexed with mg |
PDB Entry: 2ve9 (more details), 1.9 Å
SCOPe Domain Sequences for d2ve9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ve9a_ a.4.5.67 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsrevia
pap
Timeline for d2ve9a_: