SCOPe 2.05: Domain d2ve8d_: 2ve8 D:

Lineage for d2ve8d_ (2ve8 D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.67: FtsK C-terminal domain-like [140295] (2 proteins)
   PfamB PB000224
   automatically mapped to Pfam PF09397

6. Protein automated matches [190361] (1 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187192] (2 PDB entries)

8. Domain d2ve8d_: 2ve8 D: [153011]
   automated match to d2j5oa1

Details for d2ve8d_

PDB Entry: 2ve8, 1.4 Å

PDB Description: Xray structure of FtsK gamma domain (P. aeruginosa)

PDB Compounds: (D:) DNA translocase ftsk

SCOPe Domain Sequences for d2ve8d_:

Sequence; same for both SEQRES and ATOM records:

>d2ve8d_ a.4.5.67 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
seddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsrev
iapapvrd

Timeline for d2ve8d_:

• d2ve8d_ first appeared in SCOP 1.75, called d2ve8d1
  
• d2ve8d_ appears in SCOPe 2.04
  
• d2ve8d_ appears in SCOPe 2.06
  
• d2ve8d_ appears in the current release, SCOPe 2.08