SCOP 1.75: Domain d2ve6j1: 2ve6 J:182-274

Lineage for d2ve6j1 (2ve6 J:182-274)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
   Uniprot P01901 22-299

8. Domain d2ve6j1: 2ve6 J:182-274 [153006]
   Other proteins in same PDB: d2ve6a2, d2ve6d2, d2ve6g2, d2ve6j2
   automatically matched to d1ddha1
   complexed with prq

Details for d2ve6j1

PDB Entry: 2ve6, 2.65 Å

PDB Description: crystal structure of a murine mhc class i h2-db molecule in complex with a photocleavable peptide

PDB Compounds: (J:) h-2 class I histocompatibility antigen d-b alpha chain

SCOP Domain Sequences for d2ve6j1:

Sequence; same for both SEQRES and ATOM records:

>d2ve6j1 b.1.1.2 (J:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

Timeline for d2ve6j1:

• d2ve6j1 is new in SCOP 1.75
  
• d2ve6j1 appears in SCOPe 2.01
  
• d2ve6j1 appears in the current release, SCOPe 2.08