Lineage for d2ve6d2 (2ve6 D:3-180)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1020887Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1021164Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (21 PDB entries)
  8. 1021187Domain d2ve6d2: 2ve6 D:3-180 [153003]
    Other proteins in same PDB: d2ve6a1, d2ve6b_, d2ve6d1, d2ve6e_, d2ve6g1, d2ve6h_, d2ve6j1, d2ve6k_
    automatically matched to d1ddha2

Details for d2ve6d2

PDB Entry: 2ve6 (more details), 2.65 Å

PDB Description: crystal structure of a murine mhc class i h2-db molecule in complex with a photocleavable peptide
PDB Compounds: (D:) h-2 class I histocompatibility antigen d-b alpha chain

SCOPe Domain Sequences for d2ve6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ve6d2 d.19.1.1 (D:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

SCOPe Domain Coordinates for d2ve6d2:

Click to download the PDB-style file with coordinates for d2ve6d2.
(The format of our PDB-style files is described here.)

Timeline for d2ve6d2: