| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Class I MHC, alpha-3 domain [88604] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries) Uniprot P01901 22-299 |
| Domain d2ve6d1: 2ve6 D:182-274 [153002] Other proteins in same PDB: d2ve6a2, d2ve6d2, d2ve6g2, d2ve6j2 automatically matched to d1ddha1 complexed with prq |
PDB Entry: 2ve6 (more details), 2.65 Å
SCOP Domain Sequences for d2ve6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ve6d1 b.1.1.2 (D:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw
Timeline for d2ve6d1: