Lineage for d2ve6d1 (2ve6 D:182-274)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746844Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2747150Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries)
    Uniprot P01901 22-299
  8. 2747295Domain d2ve6d1: 2ve6 D:182-274 [153002]
    Other proteins in same PDB: d2ve6a2, d2ve6b_, d2ve6d2, d2ve6e_, d2ve6g2, d2ve6h_, d2ve6j2, d2ve6k_
    automatically matched to d1ddha1

Details for d2ve6d1

PDB Entry: 2ve6 (more details), 2.65 Å

PDB Description: crystal structure of a murine mhc class i h2-db molecule in complex with a photocleavable peptide
PDB Compounds: (D:) h-2 class I histocompatibility antigen d-b alpha chain

SCOPe Domain Sequences for d2ve6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ve6d1 b.1.1.2 (D:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

SCOPe Domain Coordinates for d2ve6d1:

Click to download the PDB-style file with coordinates for d2ve6d1.
(The format of our PDB-style files is described here.)

Timeline for d2ve6d1: