SCOPe 2.07: Domain d2ve6a2: 2ve6 A:3-180

Lineage for d2ve6a2 (2ve6 A:3-180)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries)

8. Domain d2ve6a2: 2ve6 A:3-180 [153001]
   Other proteins in same PDB: d2ve6a1, d2ve6b_, d2ve6d1, d2ve6e_, d2ve6g1, d2ve6h_, d2ve6j1, d2ve6k_
   automatically matched to d1ddha2

Details for d2ve6a2

PDB Entry: 2ve6, 2.65 Å

PDB Description: crystal structure of a murine mhc class i h2-db molecule in complex with a photocleavable peptide

PDB Compounds: (A:) h-2 class I histocompatibility antigen d-b alpha chain

SCOPe Domain Sequences for d2ve6a2:

Sequence; same for both SEQRES and ATOM records:

>d2ve6a2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

Timeline for d2ve6a2:

• d2ve6a2 first appeared in SCOP 1.75
  
• d2ve6a2 appears in SCOPe 2.06
  
• d2ve6a2 appears in the current release, SCOPe 2.08