Lineage for d2vdfa_ (2vdf A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3022429Superfamily f.4.4: OMPT-like [69917] (3 families) (S)
    forms (10,12) barrel
  5. 3022435Family f.4.4.2: Outer membrane adhesin/invasin OpcA [75651] (1 protein)
    automatically mapped to Pfam PF07239
  6. 3022436Protein Outer membrane adhesin/invasin OpcA [75652] (1 species)
  7. 3022437Species Neisseria meningitidis [TaxId:487] [75653] (2 PDB entries)
  8. 3022439Domain d2vdfa_: 2vdf A: [152991]
    automated match to d1k24a_
    complexed with oct, so4

Details for d2vdfa_

PDB Entry: 2vdf (more details), 1.95 Å

PDB Description: structure of the opca adhesion from neisseria meningitidis determined by crystallization from the cubic mesophase
PDB Compounds: (A:) Outer membrane protein

SCOPe Domain Sequences for d2vdfa_:

Sequence, based on SEQRES records: (download)

>d2vdfa_ f.4.4.2 (A:) Outer membrane adhesin/invasin OpcA {Neisseria meningitidis [TaxId: 487]}
aneftvhtdlssisstraflkekhkaakhigvradipfdanqgirleagfgrskkniinl
etdenklgktknvklptgvpenridlytgytytqtlsdslnfrvgaglgfesskdsiktt
khtlhssrqswlakvhadllsqlgngwyinpwsevkfdlnsryklntgvtnlkkdinqkt
ngwgfglganigkklgesasieagpfykqrtykesgefsvttksgdvsltipktsireyg
lrvgikf

Sequence, based on observed residues (ATOM records): (download)

>d2vdfa_ f.4.4.2 (A:) Outer membrane adhesin/invasin OpcA {Neisseria meningitidis [TaxId: 487]}
aneftvhtdlssisstraflkekhkaakhigvradipfdanqgirleagfgrskkniinl
etdenklgktknvklptgvpenridlytgytytqtlsdslnfrvgaglgfesskdsilhs
srqswlakvhadllsqlgngwyinpwsevkfdlnsryklntdinqktngwgfglganigk
klgasieagpfykqrtykesgefsvsltipktsireyglrvgikf

SCOPe Domain Coordinates for d2vdfa_:

Click to download the PDB-style file with coordinates for d2vdfa_.
(The format of our PDB-style files is described here.)

Timeline for d2vdfa_: