Class b: All beta proteins [48724] (180 folds) |
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.4: Alpha subunit of glutamate synthase, C-terminal domain [69336] (1 family) |
Family b.80.4.1: Alpha subunit of glutamate synthase, C-terminal domain [69337] (1 protein) this is a repeat family; one repeat unit is 1ea0 A:1280-1300 found in domain |
Protein Alpha subunit of glutamate synthase, C-terminal domain [69338] (2 species) Central domain (residues 423-780) may be a rudiment form of the FMN domain |
Species Azospirillum brasilense [TaxId:192] [69339] (2 PDB entries) |
Domain d2vdce1: 2vdc E:1203-1472 [152985] Other proteins in same PDB: d2vdca2, d2vdca3, d2vdcb2, d2vdcb3, d2vdcc2, d2vdcc3, d2vdcd2, d2vdcd3, d2vdce2, d2vdce3, d2vdcf2, d2vdcf3 automatically matched to d1ea0a1 complexed with akg, f3s, fad, fmn, omt, sf4 |
PDB Entry: 2vdc (more details), 9.5 Å
SCOPe Domain Sequences for d2vdce1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vdce1 b.80.4.1 (E:1203-1472) Alpha subunit of glutamate synthase, C-terminal domain {Azospirillum brasilense [TaxId: 192]} grnevpdtldarivadarplfeegekmqlaynarntqraigtrlssmvtrkfgmfglqpg hitirlrgtagqslgafavqgiklevmgdandyvgkglsggtivvrpttsspletnknti igntvlygatagklfaagqagerfavrnsgatvvvegcgsngceymtggtavilgrvgdn faagmtggmayvydlddslplyindesvifqrievghyesqlkhlieehvtetqsrfaae ilndwarevtkfwqvvpkemlnrlevpvhl
Timeline for d2vdce1: