Lineage for d2vdce1 (2vdc E:1203-1472)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813492Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813713Superfamily b.80.4: Alpha subunit of glutamate synthase, C-terminal domain [69336] (1 family) (S)
  5. 2813714Family b.80.4.1: Alpha subunit of glutamate synthase, C-terminal domain [69337] (1 protein)
    this is a repeat family; one repeat unit is 1ea0 A:1280-1300 found in domain
  6. 2813715Protein Alpha subunit of glutamate synthase, C-terminal domain [69338] (2 species)
    Central domain (residues 423-780) may be a rudiment form of the FMN domain
  7. 2813716Species Azospirillum brasilense [TaxId:192] [69339] (2 PDB entries)
  8. 2813723Domain d2vdce1: 2vdc E:1203-1472 [152985]
    Other proteins in same PDB: d2vdca2, d2vdca3, d2vdcb2, d2vdcb3, d2vdcc2, d2vdcc3, d2vdcd2, d2vdcd3, d2vdce2, d2vdce3, d2vdcf2, d2vdcf3
    automatically matched to d1ea0a1
    complexed with akg, f3s, fad, fmn, omt, sf4

Details for d2vdce1

PDB Entry: 2vdc (more details), 9.5 Å

PDB Description: the 9.5 a resolution structure of glutamate synthase from cryo- electron microscopy and its oligomerization behavior in solution: functional implications.
PDB Compounds: (E:) glutamate synthase [nadph] large chain

SCOPe Domain Sequences for d2vdce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdce1 b.80.4.1 (E:1203-1472) Alpha subunit of glutamate synthase, C-terminal domain {Azospirillum brasilense [TaxId: 192]}
grnevpdtldarivadarplfeegekmqlaynarntqraigtrlssmvtrkfgmfglqpg
hitirlrgtagqslgafavqgiklevmgdandyvgkglsggtivvrpttsspletnknti
igntvlygatagklfaagqagerfavrnsgatvvvegcgsngceymtggtavilgrvgdn
faagmtggmayvydlddslplyindesvifqrievghyesqlkhlieehvtetqsrfaae
ilndwarevtkfwqvvpkemlnrlevpvhl

SCOPe Domain Coordinates for d2vdce1:

Click to download the PDB-style file with coordinates for d2vdce1.
(The format of our PDB-style files is described here.)

Timeline for d2vdce1: