![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins) has slightly different topology than other families do |
![]() | Protein Alpha subunit of glutamate synthase, N-terminal domain [69833] (2 species) |
![]() | Species Azospirillum brasilense [TaxId:192] [69834] (2 PDB entries) |
![]() | Domain d2vdcd3: 2vdc D:1-422 [152984] Other proteins in same PDB: d2vdca1, d2vdca2, d2vdcb1, d2vdcb2, d2vdcc1, d2vdcc2, d2vdcd1, d2vdcd2, d2vdce1, d2vdce2, d2vdcf1, d2vdcf2 automatically matched to d1ea0a3 complexed with akg, f3s, fad, fmn, omt, sf4 has additional subdomain(s) that are not in the common domain |
PDB Entry: 2vdc (more details), 9.5 Å
SCOPe Domain Sequences for d2vdcd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vdcd3 d.153.1.1 (D:1-422) Alpha subunit of glutamate synthase, N-terminal domain {Azospirillum brasilense [TaxId: 192]} cgvgfiaaidgkprrsvvekgiealkavwhrgavdadgktgdgagihvavpqkffkdhvk vighrapdnklavgqvflprisldaqeacrciveteilafgyyiygwrqvpinvdiigek anatrpeieqiivgnnkgvsdeqfeldlyiirrriekavkgeqindfyicslsarsiiyk gmflaeqlttfypdllderfesdfaiyhqrystntfptwplaqpfrmlahngeintvkgn vnwmkahetrmehpafgthmqdlkpvigvglsdsgsldtvfevmvragrtapmvkmmlvp qaltssqttpdnhkaliqycnsvmepwdgpaalamtdgrwvvggmdrnglrpmrytittd gliiggsetgmvkidetqviekgrlgpgemiavdlqsgklyrdrelkdhlatlkpwdkwv qn
Timeline for d2vdcd3: