Lineage for d2vdcd3 (2vdc D:1-422)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548742Family d.153.1.1: Class II glutamine amidotransferases [56236] (7 protein domains)
    has slightly different topology than other families do
  6. 2548743Protein Alpha subunit of glutamate synthase, N-terminal domain [69833] (2 species)
  7. 2548744Species Azospirillum brasilense [TaxId:192] [69834] (2 PDB entries)
  8. 2548750Domain d2vdcd3: 2vdc D:1-422 [152984]
    Other proteins in same PDB: d2vdca1, d2vdca2, d2vdcb1, d2vdcb2, d2vdcc1, d2vdcc2, d2vdcd1, d2vdcd2, d2vdce1, d2vdce2, d2vdcf1, d2vdcf2
    automatically matched to d1ea0a3
    complexed with akg, f3s, fad, fmn, omt, sf4

Details for d2vdcd3

PDB Entry: 2vdc (more details), 9.5 Å

PDB Description: the 9.5 a resolution structure of glutamate synthase from cryo- electron microscopy and its oligomerization behavior in solution: functional implications.
PDB Compounds: (D:) glutamate synthase [nadph] large chain

SCOPe Domain Sequences for d2vdcd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdcd3 d.153.1.1 (D:1-422) Alpha subunit of glutamate synthase, N-terminal domain {Azospirillum brasilense [TaxId: 192]}
cgvgfiaaidgkprrsvvekgiealkavwhrgavdadgktgdgagihvavpqkffkdhvk
vighrapdnklavgqvflprisldaqeacrciveteilafgyyiygwrqvpinvdiigek
anatrpeieqiivgnnkgvsdeqfeldlyiirrriekavkgeqindfyicslsarsiiyk
gmflaeqlttfypdllderfesdfaiyhqrystntfptwplaqpfrmlahngeintvkgn
vnwmkahetrmehpafgthmqdlkpvigvglsdsgsldtvfevmvragrtapmvkmmlvp
qaltssqttpdnhkaliqycnsvmepwdgpaalamtdgrwvvggmdrnglrpmrytittd
gliiggsetgmvkidetqviekgrlgpgemiavdlqsgklyrdrelkdhlatlkpwdkwv
qn

SCOPe Domain Coordinates for d2vdcd3:

Click to download the PDB-style file with coordinates for d2vdcd3.
(The format of our PDB-style files is described here.)

Timeline for d2vdcd3: