Lineage for d2vdca2 (2vdc A:423-1193)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080028Protein Alpha subunit of glutamate synthase, central and FMN domains [69381] (2 species)
    Central domain (residues 423-780) may be a rudiment form of the FMN domain
  7. 2080029Species Azospirillum brasilense [TaxId:192] [69382] (2 PDB entries)
  8. 2080032Domain d2vdca2: 2vdc A:423-1193 [152974]
    Other proteins in same PDB: d2vdca1, d2vdca3, d2vdcb1, d2vdcb3, d2vdcc1, d2vdcc3, d2vdcd1, d2vdcd3, d2vdce1, d2vdce3, d2vdcf1, d2vdcf3
    automatically matched to d1ea0a2
    complexed with akg, f3s, fad, fmn, omt, sf4

Details for d2vdca2

PDB Entry: 2vdc (more details), 9.5 Å

PDB Description: the 9.5 a resolution structure of glutamate synthase from cryo- electron microscopy and its oligomerization behavior in solution: functional implications.
PDB Compounds: (A:) glutamate synthase [nadph] large chain

SCOPe Domain Sequences for d2vdca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdca2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]}
tthldelvktaslkgepsdmdkaelrrrqqafgltmedmelilhpmvedgkeaigsmgdd
spiavlsdkyrglhhffrqnfsqvtnppidslrerrvmslktrlgnlgnildedetqtrl
lqlespvlttaeframrdymgdtaaeidatfpvdggpealrdalrrirqetedavrggat
hviltdeamgparaaipailatgavhthlirsnlrtftslnvrtaegldthyfavligvg
attvnaylaqeaiaerhrrglfgsmplekgmanykkaiddgllkimskmgisvissyrgg
gnfeaiglsralvaehfpamvsrisgiglngiqkkvleqhatayneevvalpvggfyrfr
ksgdrhgweggvihtlqqavtndsyttfkkyseqvnkrppmqlrdllelrstkapvpvde
vesitairkrfitpgmsmgalspeahgtlnvamnrigaksdsgeggedparfrpdkngdn
wnsaikqvasgrfgvtaeylnqcreleikvaqgakpgeggqlpgfkvtemiarlrhstpg
vmlisppphhdiysiedlaqliydlkqinpdakvtvklvsrsgigtiaagvakanadiil
isgnsggtgaspqtsikfaglpwemglsevhqvltlnrlrhrvrlrtdgglktgrdivia
amlgaeefgigtasliamgcimvrqchsntcpvgvcvqddklrqkfvgtpekvvnlftfl
aeevreilaglgfrslnevigrtdllhqvsrgaehlddldlnprlaqvdpg

SCOPe Domain Coordinates for d2vdca2:

Click to download the PDB-style file with coordinates for d2vdca2.
(The format of our PDB-style files is described here.)

Timeline for d2vdca2: