Lineage for d2vdba1 (2vdb A:197-388)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343304Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2343305Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2343749Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2343750Protein automated matches [254493] (6 species)
    not a true protein
  7. 2343883Species Human (Homo sapiens) [TaxId:9606] [255068] (17 PDB entries)
  8. 2343911Domain d2vdba1: 2vdb A:197-388 [152970]
    Other proteins in same PDB: d2vdbb_
    automated match to d4l8ua2
    complexed with dka, nps

Details for d2vdba1

PDB Entry: 2vdb (more details), 2.52 Å

PDB Description: structure of human serum albumin with s-naproxen and the ga module
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d2vdba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdba1 a.126.1.0 (A:197-388) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

SCOPe Domain Coordinates for d2vdba1:

Click to download the PDB-style file with coordinates for d2vdba1.
(The format of our PDB-style files is described here.)

Timeline for d2vdba1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2vdbb_