Lineage for d2vdba1 (2vdb A:207-378)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1281391Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1281392Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 1281393Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 1281394Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 1281395Species Human (Homo sapiens) [TaxId:9606] [48555] (74 PDB entries)
    Uniprot P02768 29-596
  8. 1281599Domain d2vdba1: 2vdb A:207-378 [152970]
    Other proteins in same PDB: d2vdbb_
    automatically matched to d1n5ua1
    complexed with dka, nps

Details for d2vdba1

PDB Entry: 2vdb (more details), 2.52 Å

PDB Description: structure of human serum albumin with s-naproxen and the ga module
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d2vdba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdba1 a.126.1.1 (A:207-378) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
gerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecaddradlakyice
nqdsissklkeccekpllekshciaevendempadlpslaadfveskdvcknyaeakdvf
lgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfdefk

SCOPe Domain Coordinates for d2vdba1:

Click to download the PDB-style file with coordinates for d2vdba1.
(The format of our PDB-style files is described here.)

Timeline for d2vdba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vdba2
View in 3D
Domains from other chains:
(mouse over for more information)
d2vdbb_