SCOPe 2.07: Domain d2vd0d2: 2vd0 D:2-75

Lineage for d2vd0d2 (2vd0 D:2-75)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d2vd0d2: 2vd0 D:2-75 [152961]
   Other proteins in same PDB: d2vd0a1, d2vd0b1, d2vd0c1, d2vd0d1
   automated match to d1pd212
   complexed with d27, gol, gsh

Details for d2vd0d2

PDB Entry: 2vd0, 2.2 Å

PDB Description: complex structure of prostaglandin d2 synthase at 2.2a.

PDB Compounds: (D:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2vd0d2:

Sequence; same for both SEQRES and ATOM records:

>d2vd0d2 c.47.1.0 (D:2-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

Timeline for d2vd0d2:

• d2vd0d2 first appeared in SCOP 1.75
  
• d2vd0d2 appears in SCOPe 2.06
  
• d2vd0d2 appears in the current release, SCOPe 2.08