SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2vd0d1 (2vd0 D:76-199)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1996614Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 1997221Protein automated matches [226848] (11 species)
    not a true protein
  7. 1997235Species Human (Homo sapiens) [TaxId:9606] [224956] (42 PDB entries)
  8. 1997301Domain d2vd0d1: 2vd0 D:76-199 [152960]
    Other proteins in same PDB: d2vd0a2, d2vd0b2, d2vd0c2, d2vd0d2
    automated match to d1pd211
    complexed with d27, gol, gsh

Details for d2vd0d1

PDB Entry: 2vd0 (more details), 2.2 Å

PDB Description: complex structure of prostaglandin d2 synthase at 2.2a.
PDB Compounds: (D:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2vd0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vd0d1 a.45.1.1 (D:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d2vd0d1:

Click to download the PDB-style file with coordinates for d2vd0d1.
(The format of our PDB-style files is described here.)

Timeline for d2vd0d1: