Lineage for d2vd0b1 (2vd0 B:76-199)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 769705Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 769706Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 769707Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 770115Protein Class sigma GST [81351] (5 species)
  7. 770128Species Human (Homo sapiens) [TaxId:9606] [89061] (11 PDB entries)
    Uniprot O60760; synonym: hematopoietic prostaglandin D synthase
  8. 770164Domain d2vd0b1: 2vd0 B:76-199 [152956]
    Other proteins in same PDB: d2vd0a2, d2vd0b2, d2vd0c2, d2vd0d2
    automatically matched to d1iyha1
    complexed with d27, gol, gsh

Details for d2vd0b1

PDB Entry: 2vd0 (more details), 2.2 Å

PDB Description: complex structure of prostaglandin d2 synthase at 2.2a.
PDB Compounds: (B:) glutathione-requiring prostaglandin d synthase

SCOP Domain Sequences for d2vd0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vd0b1 a.45.1.1 (B:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOP Domain Coordinates for d2vd0b1:

Click to download the PDB-style file with coordinates for d2vd0b1.
(The format of our PDB-style files is described here.)

Timeline for d2vd0b1: