Class a: All alpha proteins [46456] (286 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein automated matches [226848] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries) |
Domain d2vd0a1: 2vd0 A:76-199 [152954] Other proteins in same PDB: d2vd0a2, d2vd0b2, d2vd0c2, d2vd0d2 automated match to d1pd211 complexed with d27, gol, gsh |
PDB Entry: 2vd0 (more details), 2.2 Å
SCOPe Domain Sequences for d2vd0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vd0a1 a.45.1.1 (A:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp qtkl
Timeline for d2vd0a1: