SCOPe 2.07: Domain d2vczb1: 2vcz B:76-199

Lineage for d2vczb1 (2vcz B:76-199)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)

8. Domain d2vczb1: 2vcz B:76-199 [152948]
   Other proteins in same PDB: d2vcza2, d2vczb2, d2vczc2, d2vczd2
   automated match to d1pd211
   complexed with gsh, vc3

Details for d2vczb1

PDB Entry: 2vcz, 1.95 Å

PDB Description: complex structure of prostaglandin d2 synthase at 1.95a.

PDB Compounds: (B:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2vczb1:

Sequence; same for both SEQRES and ATOM records:

>d2vczb1 a.45.1.1 (B:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d2vczb1:

• d2vczb1 first appeared in SCOP 1.75
  
• d2vczb1 appears in SCOPe 2.06
  
• d2vczb1 appears in the current release, SCOPe 2.08