Lineage for d2vcxc2 (2vcx C:2-75)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992315Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 992723Protein Class sigma GST [81362] (5 species)
  7. 992736Species Human (Homo sapiens) [TaxId:9606] [89705] (11 PDB entries)
    Uniprot O60760
    synonym: hematopoietic prostaglandin D synthase
  8. 992767Domain d2vcxc2: 2vcx C:2-75 [152943]
    Other proteins in same PDB: d2vcxa1, d2vcxb1, d2vcxc1, d2vcxd1
    automatically matched to d1iyha2
    complexed with d26, gsh, mg

Details for d2vcxc2

PDB Entry: 2vcx (more details), 2.1 Å

PDB Description: complex structure of prostaglandin d2 synthase at 2.1a.
PDB Compounds: (C:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2vcxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vcxc2 c.47.1.5 (C:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

SCOPe Domain Coordinates for d2vcxc2:

Click to download the PDB-style file with coordinates for d2vcxc2.
(The format of our PDB-style files is described here.)

Timeline for d2vcxc2: