Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (23 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
Protein Class sigma GST [81362] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [89705] (11 PDB entries) Uniprot O60760 synonym: hematopoietic prostaglandin D synthase |
Domain d2vcxb2: 2vcx B:2-75 [152941] Other proteins in same PDB: d2vcxa1, d2vcxb1, d2vcxc1, d2vcxd1 automatically matched to d1iyha2 complexed with d26, gsh, mg |
PDB Entry: 2vcx (more details), 2.1 Å
SCOP Domain Sequences for d2vcxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vcxb2 c.47.1.5 (B:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl hqslaiaryltknt
Timeline for d2vcxb2: