Lineage for d2vcqd1 (2vcq D:76-199)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713549Protein automated matches [226848] (14 species)
    not a true protein
  7. 2713569Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)
  8. 2713587Domain d2vcqd1: 2vcq D:76-199 [152928]
    Other proteins in same PDB: d2vcqa2, d2vcqb2, d2vcqc2, d2vcqd2
    automated match to d1pd211
    complexed with d25, gsh

Details for d2vcqd1

PDB Entry: 2vcq (more details), 1.95 Å

PDB Description: complex structure of prostaglandin d2 synthase at 1.95a.
PDB Compounds: (D:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2vcqd1:

Sequence, based on SEQRES records: (download)

>d2vcqd1 a.45.1.1 (D:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Sequence, based on observed residues (ATOM records): (download)

>d2vcqd1 a.45.1.1 (D:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmqdvkeqmfnelltynaphlmqdldtylggrewlign
svtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrpqtkl

SCOPe Domain Coordinates for d2vcqd1:

Click to download the PDB-style file with coordinates for d2vcqd1.
(The format of our PDB-style files is described here.)

Timeline for d2vcqd1: