Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188013] (102 PDB entries) |
Domain d2vcqa2: 2vcq A:2-75 [152923] Other proteins in same PDB: d2vcqa1, d2vcqb1, d2vcqc1, d2vcqd1 automated match to d1pd212 complexed with d25, gsh |
PDB Entry: 2vcq (more details), 1.95 Å
SCOPe Domain Sequences for d2vcqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vcqa2 c.47.1.0 (A:2-75) automated matches {Human (Homo sapiens) [TaxId: 9606]} pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl hqslaiaryltknt
Timeline for d2vcqa2: