SCOPe 2.03: Domain d2vcob_: 2vco B:

Lineage for d2vcob_ (2vco B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (1 species)
   duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [49407] (21 PDB entries)

8. Domain d2vcob_: 2vco B: [152921]
   automated match to d1uwfa1
   complexed with ni, so4

Details for d2vcob_

PDB Entry: 2vco, 2.1 Å

PDB Description: crystal structure of the fimbrial adhesin fimh in complex with its high-mannose epitope

PDB Compounds: (B:) protein fimh

SCOPe Domain Sequences for d2vcob_:

Sequence; same for both SEQRES and ATOM records:

>d2vcob_ b.2.3.2 (B:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d2vcob_:

• d2vcob_ first appeared in SCOP 1.75, called d2vcob1
  
• d2vcob_ appears in SCOPe 2.02
  
• d2vcob_ appears in SCOPe 2.04
  
• d2vcob_ appears in the current release, SCOPe 2.08