Lineage for d2vcob1 (2vco B:1-158)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 789808Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 789904Superfamily b.2.3: Bacterial adhesins [49401] (6 families) (S)
  5. 789909Family b.2.3.2: Pilus subunits [49405] (8 proteins)
  6. 789922Protein Mannose-specific adhesin FimH [49406] (1 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 789923Species Escherichia coli [TaxId:562] [49407] (7 PDB entries)
  8. 789929Domain d2vcob1: 2vco B:1-158 [152921]
    automatically matched to d1klfb1
    complexed with man, nag, ni, so4

Details for d2vcob1

PDB Entry: 2vco (more details), 2.1 Å

PDB Description: crystal structure of the fimbrial adhesin fimh in complex with its high-mannose epitope
PDB Compounds: (B:) protein fimh

SCOP Domain Sequences for d2vcob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vcob1 b.2.3.2 (B:1-158) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOP Domain Coordinates for d2vcob1:

Click to download the PDB-style file with coordinates for d2vcob1.
(The format of our PDB-style files is described here.)

Timeline for d2vcob1: