![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (6 families) ![]() |
![]() | Family b.2.3.2: Pilus subunits [49405] (8 proteins) |
![]() | Protein Mannose-specific adhesin FimH [49406] (1 species) duplication: consists of two domains of this fold; C-terminal domain lacks the last strand |
![]() | Species Escherichia coli [TaxId:562] [49407] (7 PDB entries) |
![]() | Domain d2vcoa1: 2vco A:1-158 [152920] automatically matched to d1klfb1 complexed with man, nag, ni, so4 |
PDB Entry: 2vco (more details), 2.1 Å
SCOP Domain Sequences for d2vcoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vcoa1 b.2.3.2 (A:1-158) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]} facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
Timeline for d2vcoa1: