SCOP 1.75: Domain d2vcoa1: 2vco A:1-158

Lineage for d2vcoa1 (2vco A:1-158)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (6 families)

5. Family b.2.3.2: Pilus subunits [49405] (8 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (1 species)
   duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [49407] (7 PDB entries)

8. Domain d2vcoa1: 2vco A:1-158 [152920]
   automatically matched to d1klfb1
   complexed with man, nag, ni, so4

Details for d2vcoa1

PDB Entry: 2vco, 2.1 Å

PDB Description: crystal structure of the fimbrial adhesin fimh in complex with its high-mannose epitope

PDB Compounds: (A:) protein fimh

SCOP Domain Sequences for d2vcoa1:

Sequence; same for both SEQRES and ATOM records:

>d2vcoa1 b.2.3.2 (A:1-158) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d2vcoa1:

• d2vcoa1 is new in SCOP 1.75
  
• d2vcoa1 appears in SCOPe 2.01
  
• d2vcoa1 appears in the current release, SCOPe 2.08, called d2vcoa_