SCOPe 2.08: Domain d2vcfx2: 2vcf X:2-251

Lineage for d2vcfx2 (2vcf X:2-251)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein automated matches [190089] (9 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [187116] (17 PDB entries)

8. Domain d2vcfx2: 2vcf X:2-251 [152916]
   Other proteins in same PDB: d2vcfx3
   automated match to d1oafa_
   complexed with hem, isz, na

Details for d2vcfx2

PDB Entry: 2vcf, 1.8 Å

PDB Description: structure of isoniazid (inh) bound to cytosolic soybean ascorbate peroxidase

PDB Compounds: (X:) ascorbate peroxidase from soybean cytosol

SCOPe Domain Sequences for d2vcfx2:

Sequence; same for both SEQRES and ATOM records:

>d2vcfx2 a.93.1.1 (X:2-251) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfadah

Timeline for d2vcfx2:

• d2vcfx2 first appeared in SCOP 1.75, called d2vcfx1
  
• d2vcfx2 appears in SCOPe 2.07