![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) ![]() |
![]() | Family a.93.1.1: CCP-like [48114] (5 proteins) |
![]() | Protein automated matches [190089] (9 species) not a true protein |
![]() | Species Soybean (Glycine max) [TaxId:3847] [187116] (17 PDB entries) |
![]() | Domain d2vcfx2: 2vcf X:2-251 [152916] Other proteins in same PDB: d2vcfx3 automated match to d1oafa_ complexed with hem, isz, na |
PDB Entry: 2vcf (more details), 1.8 Å
SCOPe Domain Sequences for d2vcfx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vcfx2 a.93.1.1 (X:2-251) automated matches {Soybean (Glycine max) [TaxId: 3847]} gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk lselgfadah
Timeline for d2vcfx2: