Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families) |
Family b.43.5.2: CTP-dependent riboflavin kinase-like [159154] (1 protein) Pfam PF01982; newly characterized archaeal family (formerly DUF120) |
Protein CTP-dependent riboflavin kinase, Rfk [159155] (2 species) |
Species Methanococcus jannaschii [TaxId:2190] [159157] (6 PDB entries) Uniprot Q60365 1-136 |
Domain d2vbva_: 2vbv A: [152912] automated match to d2p3ma1 complexed with cdp, cl, fmn, iod, mg |
PDB Entry: 2vbv (more details), 2.4 Å
SCOPe Domain Sequences for d2vbva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vbva_ b.43.5.2 (A:) CTP-dependent riboflavin kinase, Rfk {Methanococcus jannaschii [TaxId: 2190]} mvklmiiegevvsglgegryflslppykeifkkilgfepyegtlnlkldrefdinkfkyi etedfefngkrffgvkvlpikilignkkidgaivvpkktyhsseiieiiapmklreqfnl kdgdvikilikgdk
Timeline for d2vbva_: