Lineage for d2vbua1 (2vbu A:2-132)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801216Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 801665Superfamily b.43.5: Riboflavin kinase-like [82114] (2 families) (S)
  5. 801695Family b.43.5.2: CTP-dependent riboflavin kinase-like [159154] (1 protein)
    Pfam PF01982; newly characterized archaeal family (formerly DUF120)
  6. 801696Protein CTP-dependent riboflavin kinase, Rfk [159155] (2 species)
  7. 801697Species Methanococcus jannaschii [TaxId:2190] [159157] (6 PDB entries)
    Uniprot Q60365 1-136
  8. 801698Domain d2vbua1: 2vbu A:2-132 [152911]
    automatically matched to 2P3M A:1-136
    complexed with cdf, mg, mrd

Details for d2vbua1

PDB Entry: 2vbu (more details), 1.7 Å

PDB Description: riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with cdp
PDB Compounds: (A:) Riboflavin kinase

SCOP Domain Sequences for d2vbua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vbua1 b.43.5.2 (A:2-132) CTP-dependent riboflavin kinase, Rfk {Methanococcus jannaschii [TaxId: 2190]}
vklmiiegevvsglgegryflslppykeifkkilgfepyegtlnlkldrefdinkfkyie
tedfefngkrffgvkvlpikilignkkidgaivvpkktyhsseiieiiapmklreqfnlk
dgdvikilikg

SCOP Domain Coordinates for d2vbua1:

Click to download the PDB-style file with coordinates for d2vbua1.
(The format of our PDB-style files is described here.)

Timeline for d2vbua1: