Lineage for d2vbsa_ (2vbs A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403385Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families) (S)
  5. 2403416Family b.43.5.2: CTP-dependent riboflavin kinase-like [159154] (1 protein)
    Pfam PF01982; newly characterized archaeal family (formerly DUF120)
  6. 2403417Protein CTP-dependent riboflavin kinase, Rfk [159155] (2 species)
  7. 2403418Species Methanococcus jannaschii [TaxId:2190] [159157] (6 PDB entries)
    Uniprot Q60365 1-136
  8. 2403424Domain d2vbsa_: 2vbs A: [152909]
    automated match to d2vbta_
    complexed with cl, po4, zn

Details for d2vbsa_

PDB Entry: 2vbs (more details), 3 Å

PDB Description: Riboflavin kinase Mj0056 from Methanocaldococcus jannaschii in complex with PO4
PDB Compounds: (A:) Riboflavin kinase

SCOPe Domain Sequences for d2vbsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vbsa_ b.43.5.2 (A:) CTP-dependent riboflavin kinase, Rfk {Methanococcus jannaschii [TaxId: 2190]}
vklmiiegevvsglgegryflslppykeifkkilgfepyegtlnlkldrefdinkfkyie
tedfefngkrffgvkvlpikilignkkidgaivvpkktyhsseiieiiapmklreqfnlk
dgdvikilikgd

SCOPe Domain Coordinates for d2vbsa_:

Click to download the PDB-style file with coordinates for d2vbsa_.
(The format of our PDB-style files is described here.)

Timeline for d2vbsa_: