Lineage for d2vbqa2 (2vbq A:1-145)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968408Protein Aminoglycoside N-acetyltransferase AAC(6')-IY [111098] (2 species)
  7. 2968409Species Salmonella enterica [TaxId:28901] [160639] (1 PDB entry)
  8. 2968410Domain d2vbqa2: 2vbq A:1-145 [152907]
    Other proteins in same PDB: d2vbqa3
    automated match to d1s5ka_
    complexed with bsj, gol, ni

Details for d2vbqa2

PDB Entry: 2vbq (more details), 2 Å

PDB Description: structure of aac(6')-iy in complex with bisubstrate analog coa-s- monomethyl-acetylneamine.
PDB Compounds: (A:) aminoglycoside 6'-N-acetyltransferase

SCOPe Domain Sequences for d2vbqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vbqa2 d.108.1.1 (A:1-145) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enterica [TaxId: 28901]}
mdirqmnkthlehwrglrkqlwpghpddahladgeeilqadhlasfiamadgvaigfada
sirhdyvngcdsspvvflegifvlpsfrqrgvakqliaavqrwgtnkgcremasdtspen
tisqkvhqalgfeetervifyrkrc

SCOPe Domain Coordinates for d2vbqa2:

Click to download the PDB-style file with coordinates for d2vbqa2.
(The format of our PDB-style files is described here.)

Timeline for d2vbqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vbqa3
View in 3D
Domains from other chains:
(mouse over for more information)
d2vbqb_