SCOPe 2.05: Domain d2vbaa2: 2vba A:254-404

Lineage for d2vbaa2 (2vba A:254-404)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (9 proteins)

6. Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)

7. Species Escherichia coli [TaxId:562] [53908] (17 PDB entries)
   Uniprot P14926

8. Domain d2vbaa2: 2vba A:254-404 [152898]
   automated match to d1fj4a2
   complexed with p4t

Details for d2vbaa2

PDB Entry: 2vba, 1.36 Å

PDB Description: beta-ketoacyl-acp synthase i (kas) from e. coli with bound amino- thiazole inhibitor

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d2vbaa2:

Sequence; same for both SEQRES and ATOM records:

>d2vbaa2 c.95.1.1 (A:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrkl

Timeline for d2vbaa2:

• d2vbaa2 first appeared in SCOP 1.75
  
• d2vbaa2 appears in SCOPe 2.04
  
• d2vbaa2 appears in SCOPe 2.06
  
• d2vbaa2 appears in the current release, SCOPe 2.08