Lineage for d2vb8d2 (2vb8 D:254-404)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846958Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 846959Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 846960Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 846981Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
  7. 846982Species Escherichia coli [TaxId:562] [53908] (23 PDB entries)
    Uniprot P14926
  8. 846998Domain d2vb8d2: 2vb8 D:254-404 [152888]
    automatically matched to d1h4fa2
    complexed with cl, tlm

Details for d2vb8d2

PDB Entry: 2vb8 (more details), 1.52 Å

PDB Description: beta-ketoacyl-acp synthase i (kas) from e. coli with bound inhibitor thiolactomycin
PDB Compounds: (D:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOP Domain Sequences for d2vb8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vb8d2 c.95.1.1 (D:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrkl

SCOP Domain Coordinates for d2vb8d2:

Click to download the PDB-style file with coordinates for d2vb8d2.
(The format of our PDB-style files is described here.)

Timeline for d2vb8d2: