SCOP 1.75: Domain d2vb8a2: 2vb8 A:254-404

Lineage for d2vb8a2 (2vb8 A:254-404)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (8 proteins)

6. Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)

7. Species Escherichia coli [TaxId:562] [53908] (23 PDB entries)
   Uniprot P14926

8. Domain d2vb8a2: 2vb8 A:254-404 [152882]
   automatically matched to d1h4fa2
   complexed with cl, tlm

Details for d2vb8a2

PDB Entry: 2vb8, 1.52 Å

PDB Description: beta-ketoacyl-acp synthase i (kas) from e. coli with bound inhibitor thiolactomycin

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOP Domain Sequences for d2vb8a2:

Sequence; same for both SEQRES and ATOM records:

>d2vb8a2 c.95.1.1 (A:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrkl

Timeline for d2vb8a2:

• d2vb8a2 is new in SCOP 1.75
  
• d2vb8a2 appears in SCOPe 2.01
  
• d2vb8a2 appears in the current release, SCOPe 2.08